Isolation and partial characterization of a polypeptide from Phoneutria nigriventer spider venom that relaxes rabbit corpus cavernosum in vitro

• Published in: Toxicon (Oxford) 1996-10, Vol.34 (10), p.1141-1147
• Main Authors: Rego, E., Bento, A.C., B.-Lopes-Martins, R.A., Antunes, E., Novello, J.C., Marangoni, S., Giglio, J.R., Oliveira, B., De Nucci, G.
• Format: Article
• Language: English
• Subjects: Amino Acid Sequence; Animal poisons toxicology. Antivenoms; Animals; Biological and medical sciences; Ctenidae; Male; Medical sciences; Molecular Sequence Data; Penis - drug effects; Peptides - isolation & purification; Peptides - pharmacology; Phoneutria nigriventer; Rabbits; Spider Venoms - chemistry; Spider Venoms - isolation & purification; Spider Venoms - pharmacology; Toxicology
• ISSN: 0041-0101; 1879-3150
• DOI: 10.1016/0041-0101(96)00060-8

The venom of the Brazilian spider Phoneutria nigriventer was fractionated using a C18 μBondapack reverse-phase high-performance liquid chromatography column. The resulting fractions were assayed in the rabbit perfused corpus cavernosum tissue to identify those fractions responsible for the corpus cavernosum relaxation. Two fractions (A and B) with retention times of 18.1 and 36.7 min, respectively, induced relaxation of corpus cavernosum strips. Fraction A was selected for further biochemical characterization. Repurification of this fraction revealed the presence of a polypeptide (named PNV4) which migrates in sodium dodecyl sulphate-polyacrylamide gel electrophoresis as a single band consistent with a mol. wt close to 16,600. The amino acid composition of PNV4 showed the presence of 147 residues, a high content of Cys and a calculated mol. wt of 17,213 + Trp. The N-terminal amino acid sequence of PNV4 determined for its first 48 residues was AELTSCFPVGHECDGD- ASNCNCCGDDVYCGCGWGRWNCKCKVADQSYA.