A novel defensin‐like peptide from salivary glands of the hard tick, Haemaphysalis longicornis

A novel defensin‐like antimicrobial peptide named longicornsin was isolated from the salivary glands of the hard tick, Haemaphysalis longicornis, using a 10‐kDa cut‐off Centriprep filter and reversed‐phase high‐performance liquid chromatography (RP‐HPLC). Its amino acid sequence was determined as DF...

Full description

Saved in:
Bibliographic Details
Published in:Protein science 2010-03, Vol.19 (3), p.392-397
Main Authors: Lu, Xiangyun, Che, Qiaolin, Lv, Yi, Wang, Meijuan, Lu, Zekuan, Feng, Feifei, Liu, Jingze, Yu, Haining
Format: Article
Language:English
Subjects:
Amino Acid Sequence
Amino acids
Animals
Anti-Infective Agents - chemistry
Anti-Infective Agents - isolation & purification
Anti-Infective Agents - pharmacology
antimicrobial peptide
Bacteria - drug effects
Chromatography
Chromatography, High Pressure Liquid
defensin
Defensins - chemistry
Defensins - genetics
Defensins - pharmacology
Drug Resistance, Bacterial
Fungi - drug effects
Haemaphysalis longicornis
Helicobacter pylori
Helicobacter pylori - drug effects
Ixodidae
Ixodidae - chemistry
Ixodidae - metabolism
Molecular Sequence Data
salivary gland
Salivary Glands - chemistry
Salivary Glands - metabolism
tick
Citations: Items that this one cites
Items that cite this one
Online Access:Get full text
Tags: Add Tag
No Tags, Be the first to tag this record!
Description
Summary:A novel defensin‐like antimicrobial peptide named longicornsin was isolated from the salivary glands of the hard tick, Haemaphysalis longicornis, using a 10‐kDa cut‐off Centriprep filter and reversed‐phase high‐performance liquid chromatography (RP‐HPLC). Its amino acid sequence was determined as DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG by Edman degradation. The cDNA encoding longicornsin was cloned by cDNA library screening. The predicted protein from the cDNA sequence was composed of 78 amino acids including a mature longicornsin. It showed similarity with defensin‐like peptides from other ticks by BLAST search. Different from most other tick defensin‐like peptides, longicornsin had a C‐terminal extension. Purified longicornsin exerted potent antimicrobial activities against bacteria and fungi. Interestingly, it even showed strong antimicrobial ability against drug‐resistant microorganisms and Helicobacter pylori. The results of this study indicated that longicornsin is a potential candidate for novel antimicrobial drug design.
ISSN:0961-8368
1469-896X
DOI:10.1002/pro.317